DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and psmb10

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001002543.2 Gene:psmb10 / 436816 ZFINID:ZDB-GENE-040718-278 Length:276 Species:Danio rerio


Alignment Length:166 Identity:44/166 - (26%)
Similarity:75/166 - (45%) Gaps:12/166 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67
            |:.|:...|.|:|.|||.....::|..::..|||.::.::.....|.:.|.|..|:.:|.|:.|:
Zfish    44 TIAGLVFKDGVILGADTRATDDMVVADKNCMKIHYIAPNIYCCGAGVAADAEVTTQMMSSNVELH 108

  Fly    68 KMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFI----DYLANALPVN 128
            .:..|   .|...|..||:......|.:......:.|.|.|.| |.:|..:    .|  :.||  
Zfish   109 SLSTG---RPPLVAMVTRQLKQMLFRYQGHIGSSLIVGGVDVN-GAQLYSVYPHGSY--DKLP-- 165

  Fly   129 YAGHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCI 164
            :...|.||..|.|:::..:.||:...||..:.:..|
Zfish   166 FLTMGSGAASAISVFEDRYKPNMELEEAKQLVRDAI 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 44/166 (27%)
proteasome_beta_type_2 1..192 CDD:239727 44/166 (27%)
psmb10NP_001002543.2 PRE1 40..224 CDD:223711 44/166 (27%)
proteasome_beta_type_7 43..231 CDD:239732 44/166 (27%)
Pr_beta_C 237..270 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.