DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and Prosalpha4T1

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster


Alignment Length:213 Identity:40/213 - (18%)
Similarity:82/213 - (38%) Gaps:62/213 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQ--NKIHKVSDSLLISTVGESGDT------------ 53
            |.:|::|.:.|:|..:.:   |:..|:||:  .||..:...:.::..|.:.|.            
  Fly    33 TAVGVRGANCVVLGVEKS---SVSEMQEDRTVRKISMLDRHVALAFAGLTADARILINRGQVECQ 94

  Fly    54 -------EQFT-EFISKNIALYKMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPN 110
                   .|.| |:|::.:|..|.:            :|:.|      .|.|:.:...:.|.|.:
  Fly    95 SHRLNFENQVTLEYITRYLAQLKQK------------YTQCN------GRRPFGISCLIGGIDAD 141

  Fly   111 AG-------PELTFIDYLANALPVNYAGHGYGAIFASSIYDRYW--HPNITQAEAYDVFKKCIAE 166
            ..       |...|.:|.|.|.       |..|......:::.:  |...|:.:|..:..:.:.|
  Fly   142 GSARLFHTEPSGIFHEYKATAT-------GRWANTVREFFEKAYSDHEVTTKCDAIKLAMRALLE 199

  Fly   167 IQKRLVVNLKNFTVAVVD 184
            :.:...:.|:   |||::
  Fly   200 VTQMSQMRLE---VAVLE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 40/213 (19%)
proteasome_beta_type_2 1..192 CDD:239727 40/213 (19%)
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 40/213 (19%)
proteasome_alpha_type_7 5..213 CDD:239724 39/210 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441078
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.