DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and Prosbeta6

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster


Alignment Length:198 Identity:44/198 - (22%)
Similarity:82/198 - (41%) Gaps:15/198 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67
            :::.|.|.||.::||||..:....:....|:|:.|:|...::.:.|...||...|..|...:..|
  Fly    31 SIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKVRMQSY 95

  Fly    68 KMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTF-IDYLANALPVNY-A 130
            :..:...::....|...  ::|.|.|...||.|...:||.| |.|..:.: .|.:.:.....| |
  Fly    96 EHTHLRTMTTEAVAQML--SIAMYNRRFFPYYVSNILAGID-NEGKGVVYSYDPIGHCEKATYRA 157

  Fly   131 GHGYGAIFASSIYDRYWHPN----------ITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDK 185
            |...|.:....:.::..|.|          :|:..|..|.........:|.:....:..:.::.|
  Fly   158 GGTAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSVASDTFISAAERDIYTGDSVLINIITK 222

  Fly   186 DGV 188
            ||:
  Fly   223 DGI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 44/198 (22%)
proteasome_beta_type_2 1..192 CDD:239727 44/198 (22%)
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 44/198 (22%)
PRE1 24..225 CDD:223711 43/196 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441144
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.