DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and psmb1

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_988993.1 Gene:psmb1 / 394589 XenbaseID:XB-GENE-970603 Length:239 Species:Xenopus tropicalis


Alignment Length:202 Identity:46/202 - (22%)
Similarity:84/202 - (41%) Gaps:12/202 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67
            |:|.:.|.||.::|:||..:....:...:..|.:|::|:.:|...|...|....|:.|...:.:|
 Frog    37 TVLALAGDDFALVASDTRLSEGYSIHSRNTPKCYKLTDNTVIGCTGFHADCLTLTKIIEARLKMY 101

  Fly    68 KMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFIDYLANALPVNY-AG 131
            |..|...::....|......|  |.|...||.|:..:.|.|......:...|.:.:.....| ||
 Frog   102 KHSNNKTMTSGAIAAMLSTIL--YSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDAYKAG 164

  Fly   132 HGYGAIFASSIYDRYWHPN--------ITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDGV 188
            ....|:....:.::..:.|        :|..:|..:.|.......:|.|.......:::|.|||:
 Frog   165 GSASAMLQPLLDNQIGYKNMQNVEQLPLTLEKALKLIKDVFISAAERDVYTGDALHISIVTKDGI 229

  Fly   189 RDLEPIS 195
            |: |.:|
 Frog   230 RE-ESVS 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 45/199 (23%)
proteasome_beta_type_2 1..192 CDD:239727 44/197 (22%)
psmb1NP_988993.1 proteasome_beta_type_1 28..239 CDD:239726 46/202 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.