DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and Prosbeta5R1

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_611776.1 Gene:Prosbeta5R1 / 37690 FlyBaseID:FBgn0034842 Length:315 Species:Drosophila melanogaster


Alignment Length:173 Identity:39/173 - (22%)
Similarity:75/173 - (43%) Gaps:25/173 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67
            |.||.|....|:|.||:.......:..:...||.:::|.:|.:..|.:.|...:...::|...|:
  Fly    73 TTLGFKYRGGVILCADSRATSGQYIGSQTMRKIVELNDYMLGTLAGGAADCVYWDRVLAKECRLH 137

  Fly    68 KMRNGYDLSPRESAHFTRKNLAEYLRSR------TPYQ-----VFMFVAGYDPNAGPELTFIDYL 121
            ::|             .||.:.....:|      |.|:     :.|.:||:| :.||:|.::|..
  Fly   138 QLR-------------YRKRMTVDTAARIICNISTEYKGMGLVMGMMLAGFD-DEGPKLIYVDSE 188

  Fly   122 ANALPVNYAGHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCI 164
            ...........|.|:.:|..:.|..:..:::..||||:.::.|
  Fly   189 GMRSHGQVFSVGSGSPYALGVLDTGYRYDLSDQEAYDLARRAI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 39/173 (23%)
proteasome_beta_type_2 1..192 CDD:239727 39/173 (23%)
Prosbeta5R1NP_611776.1 PTZ00488 39..272 CDD:185666 39/173 (23%)
proteasome_beta_type_5 72..259 CDD:239730 39/173 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440939
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.