DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and Psma8

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001102354.1 Gene:Psma8 / 364814 RGDID:1311659 Length:250 Species:Rattus norvegicus


Alignment Length:232 Identity:45/232 - (19%)
Similarity:92/232 - (39%) Gaps:72/232 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQ--NKIHKVSDSLLISTVGESGD------------- 52
            |.:||:|.:.|:|..:   .:|:..:::::  .||..:.|.:.::..|.:.|             
  Rat    33 TAVGIRGTNIVVLGVE---KKSVAKLQDERTVRKICALDDHVCMAFAGLTADARVVISRARVECQ 94

  Fly    53 TEQFT-------EFISKNIALYKMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPN 110
            :.:.|       |:|::.||..|.:            :|:.|      .|.|:.:...:.|:|.:
  Rat    95 SHKLTVEDPVTVEYITRFIATLKQK------------YTQSN------GRRPFGISALIVGFDDD 141

  Fly   111 AGPEL-------TFIDYLANALPVNYAGHGYGAIFASSIYDRYWHPNITQ------AEAYDVFKK 162
            ..|.|       |:..:.|||:       |..|.......::    |.|:      .||..:..|
  Rat   142 GIPRLYQTDPSGTYHAWKANAI-------GRSAKTVREFLEK----NYTEDAISNDNEAIKLAIK 195

  Fly   163 CIAEIQKRLVVNLKNFTVAVVDKDGVRDLEPISAASL 199
            .:.|:.:.   ..||..:|::.:|  :.|:..||..:
  Rat   196 ALLEVVQS---GGKNIELAIIRRD--QPLKMFSAKEI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 43/225 (19%)
proteasome_beta_type_2 1..192 CDD:239727 42/223 (19%)
Psma8NP_001102354.1 PRK03996 5..234 CDD:235192 45/232 (19%)
proteasome_alpha_type_7 5..213 CDD:239724 41/214 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.