DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and Prosbeta4R2

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster


Alignment Length:199 Identity:110/199 - (55%)
Similarity:153/199 - (76%) Gaps:0/199 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIA 65
            |||:||||||||||||:||..|:|::.||:||:|||::||..:::|||:.|||.|||:|||||:.
  Fly     3 METILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLH 67

  Fly    66 LYKMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFIDYLANALPVNYA 130
            |||:.:||.||.:.:||||||.||:|:|:.|.|||.|.:||||...||:|.:||....|..:|:|
  Fly    68 LYKISHGYHLSAKSAAHFTRKTLADYIRTNTRYQVAMLLAGYDAVEGPDLHYIDSYGAAQSINHA 132

  Fly   131 GHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDGVRDLEPIS 195
            |||:|::|..||..|||:..::|.:||.:.|||:.|||:||::|.:||.|.|||..|:|.:|.|:
  Fly   133 GHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNFEVYVVDSKGMRKMEAIN 197

  Fly   196 AASL 199
            ..||
  Fly   198 PGSL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 107/192 (56%)
proteasome_beta_type_2 1..192 CDD:239727 106/190 (56%)
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 106/190 (56%)
proteasome_beta_type_2 3..194 CDD:239727 106/190 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449310
Domainoid 1 1.000 143 1.000 Domainoid score I1496
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1634
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392180at2759
OrthoFinder 1 1.000 - - FOG0002770
OrthoInspector 1 1.000 - - otm26564
orthoMCL 1 0.900 - - OOG6_102061
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1860
1110.800

Return to query results.
Submit another query.