DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and Prosbeta4R1

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_608698.2 Gene:Prosbeta4R1 / 33449 FlyBaseID:FBgn0031442 Length:215 Species:Drosophila melanogaster


Alignment Length:199 Identity:86/199 - (43%)
Similarity:136/199 - (68%) Gaps:0/199 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIA 65
            |||:||:||.||::||:||...:|.:.:.::..|.|::||..::||.|:.||..:|::||.:|:.
  Fly     1 METILGVKGTDFIILASDTMRNKSAMWLDDEVRKTHRISDYCMMSTAGDGGDCLKFSDFILRNMD 65

  Fly    66 LYKMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFIDYLANALPVNYA 130
            |||:.|||||:.|.:.||.|::|:.||:|...:||.:.|.|||..:||||.:||||.|::||.|.
  Fly    66 LYKITNGYDLTVRGAVHFIRRHLSAYLKSDCTFQVSLLVGGYDLTSGPELHYIDYLGNSVPVRYG 130

  Fly   131 GHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDGVRDLEPIS 195
            |||....|.:.|.:.::.|::....||||.|||:.|:.||.|:||:|..:.::.|:|:..:..|:
  Fly   131 GHGAAMNFCTPILEEFYKPDMDTQAAYDVIKKCVIELYKRFVINLRNIDLFLISKNGITKMNSIN 195

  Fly   196 AASL 199
            ..||
  Fly   196 LESL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 83/192 (43%)
proteasome_beta_type_2 1..192 CDD:239727 83/190 (44%)
Prosbeta4R1NP_608698.2 PRE1 1..204 CDD:223711 86/199 (43%)
proteasome_beta_type_2 1..193 CDD:239727 83/191 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449309
Domainoid 1 1.000 143 1.000 Domainoid score I1496
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1634
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392180at2759
OrthoFinder 1 1.000 - - FOG0002770
OrthoInspector 1 1.000 - - mtm1116
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1860
109.900

Return to query results.
Submit another query.