DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and psmb5

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_571226.1 Gene:psmb5 / 30387 ZFINID:ZDB-GENE-990415-215 Length:269 Species:Danio rerio


Alignment Length:175 Identity:39/175 - (22%)
Similarity:73/175 - (41%) Gaps:17/175 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67
            |.|..|....|::|.|:.......:..:...|:.:::..||.:..|.:.|...:...:::...:|
Zfish    67 TTLAFKFQHGVIVAVDSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIY 131

  Fly    68 KMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQ-------VFMFVAGYDPNAGPELTFIDYLANAL 125
            ::||    ..|.|.....|.||..:     ||       :...|.|:| ..||.|.::|...|.:
Zfish   132 ELRN----KERISVAAASKLLANMV-----YQYKGMGLSMGTMVCGWD-KRGPGLYYVDSEGNRV 186

  Fly   126 PVNYAGHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKR 170
            .......|.|:::|..:.|.....::|..||.|:.::.|.:...|
Zfish   187 CGGLFAVGSGSMYAYGVVDSGLRYDLTIDEACDLGRRAIYQATYR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 39/175 (22%)
proteasome_beta_type_2 1..192 CDD:239727 39/175 (22%)
psmb5NP_571226.1 PTZ00488 44..268 CDD:185666 39/175 (22%)
proteasome_beta_type_5 66..253 CDD:239730 39/175 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.