DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and Psmb2

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_058980.1 Gene:Psmb2 / 29675 RGDID:61874 Length:201 Species:Rattus norvegicus


Alignment Length:195 Identity:101/195 - (51%)
Similarity:145/195 - (74%) Gaps:0/195 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIA 65
            ||.|:||:|||:|::|:|...|.:|:.||:|.:|:.|:|:.:|:..|||:|||.||.|:|.||:.
  Rat     1 MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQ 65

  Fly    66 LYKMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFIDYLANALPVNYA 130
            ||||||||:|||..:|:|||:|||:.|||||||.|.:.:||||.:.||.|.::||||......:|
  Rat    66 LYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFA 130

  Fly   131 GHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDGVRDLEPIS 195
            .|||||....||.|||:.|.|::..|.::.:||:.|:|||.::||..|:|.|:||||:.:||.|:
  Rat   131 AHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRVIDKDGIHNLENIT 195

  Fly   196  195
              Rat   196  195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 100/192 (52%)
proteasome_beta_type_2 1..192 CDD:239727 98/190 (52%)
Psmb2NP_058980.1 proteasome_beta_type_2 1..192 CDD:239727 98/190 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340976
Domainoid 1 1.000 200 1.000 Domainoid score I2943
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2088
Inparanoid 1 1.050 220 1.000 Inparanoid score I3471
OMA 1 1.010 - - QHG53714
OrthoDB 1 1.010 - - D1392180at2759
OrthoFinder 1 1.000 - - FOG0002770
OrthoInspector 1 1.000 - - otm45001
orthoMCL 1 0.900 - - OOG6_102061
Panther 1 1.100 - - LDO PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1860
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.