DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and Psma4

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_058977.1 Gene:Psma4 / 29671 RGDID:61846 Length:261 Species:Rattus norvegicus


Alignment Length:202 Identity:47/202 - (23%)
Similarity:76/202 - (37%) Gaps:34/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67
            |.|||...|.|:|||:..:...::.......||:|:::.:..|..|.:.|....|    ..:.|.
  Rat    33 TCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLT----NELRLI 93

  Fly    68 KMRNGYDLSPRE--------SAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFIDYLANA 124
            ..|  |.|..:|        :|....|........:.|:.|.:...|:|.:.|.:|...|...| 
  Rat    94 AQR--YLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGN- 155

  Fly   125 LPVNYAGHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDGVR 189
                     ||...|:.|.:       ..|.|..:.|:...|.:..|...|. ..|.|::|  ..
  Rat   156 ---------YGGWKATCIGN-------NSAAAVSMLKQDYKEGEMTLKSALA-LAVKVLNK--TM 201

  Fly   190 DLEPISA 196
            |:..:||
  Rat   202 DVSKLSA 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 45/198 (23%)
proteasome_beta_type_2 1..192 CDD:239727 45/196 (23%)
Psma4NP_058977.1 proteasome_alpha_type_4 3..216 CDD:239721 47/202 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.