DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and Psmb3

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_036101.1 Gene:Psmb3 / 26446 MGIID:1347014 Length:205 Species:Mus musculus


Alignment Length:196 Identity:40/196 - (20%)
Similarity:79/196 - (40%) Gaps:22/196 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALYK 68
            ::.:||.:.|.:|||........::..|..||..:.|.|.|...|.:.|.:...:.:...:.||:
Mouse    11 VMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYE 75

  Fly    69 MRNGYDLSPRESAHFTRKNLAE---YLRSRTPYQVFMFVAGYDPNA-GPELTFIDYLANALPV-N 128
            ::.|..:.|     :|..::..   |.:...||.....:||.||.. .|.:..:|.:...:.. :
Mouse    76 LKEGRQIKP-----YTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDD 135

  Fly   129 YAGHG------YGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDG 187
            :...|      ||      :.:..|.||:.....::...:.:.....|..|:.....|.|::||.
Mouse   136 FVVSGTCSEQMYG------MCESLWEPNMDPEHLFETISQAMLNAVDRDAVSGMGVIVHVIEKDK 194

  Fly   188 V 188
            :
Mouse   195 I 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 40/196 (20%)
proteasome_beta_type_2 1..192 CDD:239727 40/196 (20%)
Psmb3NP_036101.1 proteasome_beta_type_3 6..201 CDD:239728 40/196 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.