Sequence 1: | NP_001260511.1 | Gene: | Prosbeta4 / 34999 | FlyBaseID: | FBgn0032596 | Length: | 201 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036096.1 | Gene: | Psma4 / 26441 | MGIID: | 1347060 | Length: | 261 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 47/202 - (23%) |
---|---|---|---|
Similarity: | 76/202 - (37%) | Gaps: | 34/202 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67
Fly 68 KMRNGYDLSPRE--------SAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFIDYLANA 124
Fly 125 LPVNYAGHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDGVR 189
Fly 190 DLEPISA 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta4 | NP_001260511.1 | PRE1 | 1..194 | CDD:223711 | 45/198 (23%) |
proteasome_beta_type_2 | 1..192 | CDD:239727 | 45/196 (23%) | ||
Psma4 | NP_036096.1 | proteasome_alpha_type_4 | 3..216 | CDD:239721 | 47/202 (23%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 240..261 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |