DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and Psmb8

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_542945.2 Gene:Psmb8 / 24968 RGDID:3426 Length:276 Species:Rattus norvegicus


Alignment Length:202 Identity:45/202 - (22%)
Similarity:85/202 - (42%) Gaps:13/202 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67
            |.|..|....|::|.|:..:....:.....||:.:::..||.:..|.:.|.:.:...::|...||
  Rat    74 TTLAFKFQHGVIVAVDSRASAGSYIATIRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLY 138

  Fly    68 KMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFIDYLANALPVNYAGH 132
            .:|||..:|...::......:.:|  ......:...:.|:| ..||.|.::|.....|.......
  Rat   139 YLRNGERISVSAASKLLSNMMLQY--RGMGLSMGSMICGWD-KKGPGLYYVDDNGTRLSGQMFST 200

  Fly   133 GYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKR-----LVVNLKNFTVAVVDKDGVRDLE 192
            |.|..:|..:.|..:..:::..||||:.::.|.....|     .|||:.:     :.|||...:|
  Rat   201 GSGNTYAYGVMDSGYRQDLSPEEAYDLARRAIVYATHRDSYSGGVVNMYH-----MKKDGWVKVE 260

  Fly   193 PISAASL 199
            ....:.|
  Rat   261 STDVSDL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 44/195 (23%)
proteasome_beta_type_2 1..192 CDD:239727 43/193 (22%)
Psmb8NP_542945.2 PTZ00488 40..271 CDD:185666 45/202 (22%)
proteasome_beta_type_5 73..260 CDD:239730 43/193 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.