DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and Psmb7

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_035317.1 Gene:Psmb7 / 19177 MGIID:107637 Length:277 Species:Mus musculus


Alignment Length:201 Identity:49/201 - (24%)
Similarity:91/201 - (45%) Gaps:20/201 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67
            |:.|:...|.::|.|||.....::|..::.:|||.:|.::.....|.:.||:..|:.||.|:.|:
Mouse    45 TIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELH 109

  Fly    68 KMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVF----MFVAGYDPNAGPELTFIDYLANALPVN 128
            .:..|     |.....|...:.:.:..|  ||.:    :.:.|.|. .||.|..|....:...:.
Mouse   110 SLTTG-----RLPRVVTANRMLKQMLFR--YQGYIGAALVLGGVDV-TGPHLYSIYPHGSTDKLP 166

  Fly   129 YAGHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRLVVN----LKNFTVAVVDKDGVR 189
            |...|.|::.|.::::..:.|::.:.||    ||.::|.....:.|    ..|..:.|:.|..:.
Mouse   167 YVTMGSGSLAAMAVFEDKFRPDMEEEEA----KKLVSEAIAAGIFNDLGSGSNIDLCVISKSKLD 227

  Fly   190 DLEPIS 195
            .|.|.|
Mouse   228 FLRPFS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 47/198 (24%)
proteasome_beta_type_2 1..192 CDD:239727 46/196 (23%)
Psmb7NP_035317.1 PRE1 41..225 CDD:223711 46/191 (24%)
proteasome_beta_type_7 44..232 CDD:239732 47/198 (24%)
Pr_beta_C 236..271 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.