Sequence 1: | NP_001260511.1 | Gene: | Prosbeta4 / 34999 | FlyBaseID: | FBgn0032596 | Length: | 201 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_035317.1 | Gene: | Psmb7 / 19177 | MGIID: | 107637 | Length: | 277 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 49/201 - (24%) |
---|---|---|---|
Similarity: | 91/201 - (45%) | Gaps: | 20/201 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67
Fly 68 KMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVF----MFVAGYDPNAGPELTFIDYLANALPVN 128
Fly 129 YAGHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRLVVN----LKNFTVAVVDKDGVR 189
Fly 190 DLEPIS 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta4 | NP_001260511.1 | PRE1 | 1..194 | CDD:223711 | 47/198 (24%) |
proteasome_beta_type_2 | 1..192 | CDD:239727 | 46/196 (23%) | ||
Psmb7 | NP_035317.1 | PRE1 | 41..225 | CDD:223711 | 46/191 (24%) |
proteasome_beta_type_7 | 44..232 | CDD:239732 | 47/198 (24%) | ||
Pr_beta_C | 236..271 | CDD:289249 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |