DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and Psmb1

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_035315.1 Gene:Psmb1 / 19170 MGIID:104884 Length:240 Species:Mus musculus


Alignment Length:197 Identity:44/197 - (22%)
Similarity:76/197 - (38%) Gaps:11/197 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67
            |:|.|.|.||.::|:||..:....:...|..|.:|::|..:|...|..||....|:.|...:.:|
Mouse    38 TVLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMY 102

  Fly    68 KMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFIDYLANALPVNYAGH 132
            |..|...::....|......|  |.|...||.|:..:.|.|......:...|.:.:....::...
Mouse   103 KHSNNKAMTTGAIAAMLSTIL--YSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAG 165

  Fly   133 GYGAIFASSIYD---------RYWHPNITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDGV 188
            |..:.....:.|         ...|..:|...|..:.|.......:|.|.......:.:|.|:|:
Mouse   166 GSASAMLQPLLDNQVGFKNMQNVEHVPLTLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGI 230

  Fly   189 RD 190
            |:
Mouse   231 RE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 44/197 (22%)
proteasome_beta_type_2 1..192 CDD:239727 44/197 (22%)
Psmb1NP_035315.1 PRE1 18..240 CDD:223711 44/197 (22%)
proteasome_beta_type_1 29..240 CDD:239726 44/197 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.