DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and pbs-3

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_494913.1 Gene:pbs-3 / 173858 WormBaseID:WBGene00003949 Length:204 Species:Caenorhabditis elegans


Alignment Length:187 Identity:43/187 - (22%)
Similarity:78/187 - (41%) Gaps:3/187 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67
            |::.:.|.:.|.:|:|......:..:..||.|:|||:|.:.:...|...|.....|.|.....||
 Worm    10 TVVAMAGDECVCIASDLRIGEQMTTIATDQKKVHKVTDKVYVGLAGFQSDARTVLEKIMFRKNLY 74

  Fly    68 KMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFIDYL-ANALPVNYAG 131
            ::|...::.|:..:... .||| |......|.....|||.|....|.:..:|.: ..:.|.::..
 Worm    75 ELRENRNIKPQVLSEMI-SNLA-YQHRFGSYFTEPLVAGLDDTNKPYICCMDTIGCVSAPRDFVA 137

  Fly   132 HGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDGV 188
            .|.|..:...:.:.:|..|:...|.::...:.|....:|...:.....|..:.||.|
 Worm   138 VGTGQEYLLGVCENFWRENMKPDELFEATAQSILSCLERDAASGWGAVVYTITKDKV 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 43/187 (23%)
proteasome_beta_type_2 1..192 CDD:239727 43/187 (23%)
pbs-3NP_494913.1 PRE1 3..193 CDD:223711 41/184 (22%)
proteasome_beta_type_3 6..200 CDD:239728 43/187 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.