DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and PSMA8

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_653263.2 Gene:PSMA8 / 143471 HGNCID:22985 Length:256 Species:Homo sapiens


Alignment Length:236 Identity:42/236 - (17%)
Similarity:89/236 - (37%) Gaps:80/236 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKV---------SDSLLISTVGESGD------ 52
            |.:||:|.:.|:|..:    :..:...:|:..:.|:         :.::|...:|.:.|      
Human    33 TAVGIRGTNIVVLGVE----KKSVAKLQDERTVRKICALDDHVCMAFAVLTIFIGLTADARVVIN 93

  Fly    53 -------TEQFT-------EFISKNIALYKMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMF 103
                   :.:.|       |:|::.||..|.:            :|:.|      .|.|:.:...
Human    94 RARVECQSHKLTVEDPVTVEYITRFIATLKQK------------YTQSN------GRRPFGISAL 140

  Fly   104 VAGYDPN-------AGPELTFIDYLANALPVNYAGHGYGAIFASSIYDRYWHPNITQ------AE 155
            :.|:|.:       ..|..|:..:.|||:       |..|.......::    |.|:      :|
Human   141 IVGFDDDGISRLYQTDPSGTYHAWKANAI-------GRSAKTVREFLEK----NYTEDAIASDSE 194

  Fly   156 AYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDGVRDLEPISA 196
            |..:..|.:.|:.:.   ..||..:|::.::  :.|:..||
Human   195 AIKLAIKALLEVVQS---GGKNIELAIIRRN--QPLKMFSA 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 40/232 (17%)
proteasome_beta_type_2 1..192 CDD:239727 39/230 (17%)
PSMA8NP_653263.2 PRK03996 5..237 CDD:235192 42/236 (18%)
proteasome_alpha_type_7 5..219 CDD:239724 39/221 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.