DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and PSMB11

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001093250.1 Gene:PSMB11 / 122706 HGNCID:31963 Length:300 Species:Homo sapiens


Alignment Length:183 Identity:43/183 - (23%)
Similarity:74/183 - (40%) Gaps:17/183 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ETLLGIKGPDF--------------VMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGD 52
            :|.|.|.||..              |:.||||..:....|......|:..|...||.:|.|.|.|
Human    36 QTFLQIHGPRLAHGTTTLAFRFRHGVIAAADTRSSCGSYVACPASCKVIPVHQHLLGTTSGTSAD 100

  Fly    53 TEQFTEFISKNIALYKMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTF 117
            ...:...:.:.:.|.::|.|...|...:|......:::|  ......|...:.|:| .:||||.:
Human   101 CATWYRVLQRELRLRELREGQLPSVASAAKLLSAMMSQY--RGLDLCVATALCGWD-RSGPELFY 162

  Fly   118 IDYLANALPVNYAGHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKR 170
            :......|..:....|.|:.:|..:.||.:..:::..|||.:.:..:|....|
Human   163 VYSDGTRLQGDIFSVGSGSPYAYGVLDRGYRYDMSTQEAYALARCAVAHATHR 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 43/183 (23%)
proteasome_beta_type_2 1..192 CDD:239727 43/183 (23%)
PSMB11NP_001093250.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
proteasome_beta_type_5 50..237 CDD:239730 38/169 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.