DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17996 and AT5G16060

DIOPT Version :9

Sequence 1:NP_609803.1 Gene:CG17996 / 34998 FlyBaseID:FBgn0032595 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_197110.1 Gene:AT5G16060 / 831463 AraportID:AT5G16060 Length:95 Species:Arabidopsis thaliana


Alignment Length:89 Identity:28/89 - (31%)
Similarity:45/89 - (50%) Gaps:4/89 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DTRLRKVEREVLIPKIMRDRAKTEFCSKEVADFQECCKASSILMVATCRKQNSALKECLTQWYQN 86
            :..::|...|.|..| |:.:|..| |.:.|:.:.:|....:..:|.|||||...|..||.| :.|
plant    10 ENHVKKKVEEALRSK-MKAKALME-CDQYVSKYAQCATGRTFSVVWTCRKQARELNTCLHQ-FTN 71

  Fly    87 EAFKEECKQIYL-QERADYRSTGI 109
            :...||.|:.|: ||.....::.|
plant    72 DNVLEEMKRAYMVQEEGKVSASAI 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17996NP_609803.1 Cmc1 34..103 CDD:285749 24/69 (35%)
AT5G16060NP_197110.1 Cmc1 21..86 CDD:400756 23/67 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1575179at2759
OrthoFinder 1 1.000 - - FOG0005576
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104789
Panther 1 1.100 - - LDO PTHR22977
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.