DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17996 and cmc1

DIOPT Version :9

Sequence 1:NP_609803.1 Gene:CG17996 / 34998 FlyBaseID:FBgn0032595 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_998491.2 Gene:cmc1 / 406630 ZFINID:ZDB-GENE-040426-2626 Length:107 Species:Danio rerio


Alignment Length:116 Identity:56/116 - (48%)
Similarity:74/116 - (63%) Gaps:13/116 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LEQQPAVDPHNPHGLGDPNDTRLRKVEREVLIPKIMRDRAKTEFCSKEVADFQECCKASSILMVA 67
            ::...|.:||            ||.|||:|||||:||::|| |.|.::|..|..|||.|...||.
Zfish     1 MDPPKAEEPH------------LRHVERDVLIPKMMREKAK-ERCVQQVDAFNVCCKDSGFFMVF 52

  Fly    68 TCRKQNSALKECLTQWYQNEAFKEECKQIYLQERADYRSTGIPKKHRLEKL 118
            .||::|:||||||||.|::..|.|||||.||:|:..|..||:|.|.|.:||
Zfish    53 KCREENAALKECLTQHYRDPVFFEECKQEYLKEKLQYEQTGVPTKSRKQKL 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17996NP_609803.1 Cmc1 34..103 CDD:285749 38/68 (56%)
cmc1NP_998491.2 Cmc1 20..88 CDD:285749 38/68 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I8649
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12207
Inparanoid 1 1.050 109 1.000 Inparanoid score I4880
OMA 1 1.010 - - QHG49188
OrthoDB 1 1.010 - - D1575179at2759
OrthoFinder 1 1.000 - - FOG0005576
OrthoInspector 1 1.000 - - oto41711
orthoMCL 1 0.900 - - OOG6_104789
Panther 1 1.100 - - LDO PTHR22977
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5217
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.980

Return to query results.
Submit another query.