DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17996 and Cmc1

DIOPT Version :9

Sequence 1:NP_609803.1 Gene:CG17996 / 34998 FlyBaseID:FBgn0032595 Length:118 Species:Drosophila melanogaster
Sequence 2:XP_038937737.1 Gene:Cmc1 / 363162 RGDID:1305283 Length:174 Species:Rattus norvegicus


Alignment Length:122 Identity:59/122 - (48%)
Similarity:78/122 - (63%) Gaps:24/122 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PNDTRLRKVEREVLIPKIMRDRAKTEFCSKEV-----------------------ADFQECCKAS 61
            |::..||.||::||||||||::|: |.||::|                       :||..|||.|
  Rat    50 PSEQHLRHVEKDVLIPKIMREKAR-ERCSEQVEDGDLQLVISIQLTPTSRHHVPRSDFTRCCKDS 113

  Fly    62 SILMVATCRKQNSALKECLTQWYQNEAFKEECKQIYLQERADYRSTGIPKKHRLEKL 118
            .||||..|||:|||||:|||.:|.:.||.||||..||:||.::|.||:|.|.||:||
  Rat   114 GILMVLKCRKENSALKDCLTAYYNDPAFYEECKLEYLKEREEFRRTGVPTKKRLQKL 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17996NP_609803.1 Cmc1 34..103 CDD:285749 43/91 (47%)
Cmc1XP_038937737.1 Cmc1 64..155 CDD:400756 43/91 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I7623
eggNOG 1 0.900 - - E1_KOG4624
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12207
Inparanoid 1 1.050 126 1.000 Inparanoid score I4600
OMA 1 1.010 - - QHG49188
OrthoDB 1 1.010 - - D1575179at2759
OrthoFinder 1 1.000 - - FOG0005576
OrthoInspector 1 1.000 - - oto98696
orthoMCL 1 0.900 - - OOG6_104789
Panther 1 1.100 - - LDO PTHR22977
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5217
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.