DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17996 and F01F1.2

DIOPT Version :9

Sequence 1:NP_609803.1 Gene:CG17996 / 34998 FlyBaseID:FBgn0032595 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_498273.1 Gene:F01F1.2 / 175828 WormBaseID:WBGene00017159 Length:161 Species:Caenorhabditis elegans


Alignment Length:109 Identity:32/109 - (29%)
Similarity:54/109 - (49%) Gaps:5/109 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PH----NPHGLGDPNDTRLRKVEREVLIPKIMRDRAKTEFCSKEVADFQECCKA-SSILMVATCR 70
            ||    .|||||||.|..|||:|.:|:||..|..:.:...|::.......|.:. .::..:.||:
 Worm    38 PHYSAGGPHGLGDPEDRTLRKIEADVIIPNRMNTQIERVDCNESYLGLITCFRTDGAVSGLNTCK 102

  Fly    71 KQNSALKECLTQWYQNEAFKEECKQIYLQERADYRSTGIPKKHR 114
            ........|..:.:.:.||:.:....|:.||:..|:||:..:.|
 Worm   103 PALELFNRCKYEKFHDPAFRAKMTDEYIAERSAARATGMTSQQR 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17996NP_609803.1 Cmc1 34..103 CDD:285749 13/69 (19%)
F01F1.2NP_498273.1 Cmc1 65..135 CDD:285749 13/69 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4624
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I4004
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49188
OrthoDB 1 1.010 - - D1575179at2759
OrthoFinder 1 1.000 - - FOG0005576
OrthoInspector 1 1.000 - - oto19043
orthoMCL 1 0.900 - - OOG6_104789
Panther 1 1.100 - - LDO PTHR22977
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3750
SonicParanoid 1 1.000 - - X5217
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.870

Return to query results.
Submit another query.