DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17996 and cmc1

DIOPT Version :9

Sequence 1:NP_609803.1 Gene:CG17996 / 34998 FlyBaseID:FBgn0032595 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_001107542.1 Gene:cmc1 / 100135408 XenbaseID:XB-GENE-971040 Length:107 Species:Xenopus tropicalis


Alignment Length:97 Identity:53/97 - (54%)
Similarity:70/97 - (72%) Gaps:1/97 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DTRLRKVEREVLIPKIMRDRAKTEFCSKEVADFQECCKASSILMVATCRKQNSALKECLTQWYQN 86
            |..||.||::||||||||::|:. .||.:|..|.:|||.|.:|||..||.:|:|||||||..|::
 Frog     8 DQFLRHVEKDVLIPKIMREKARV-LCSDKVEAFTKCCKESGLLMVVKCRNENAALKECLTLHYKD 71

  Fly    87 EAFKEECKQIYLQERADYRSTGIPKKHRLEKL 118
            .|..|||||.||:||.:::.|||..|.|.||:
 Frog    72 PALYEECKQEYLKEREEFQKTGISSKKRQEKV 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17996NP_609803.1 Cmc1 34..103 CDD:285749 39/68 (57%)
cmc1NP_001107542.1 Cmc1 20..88 CDD:369973 39/68 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I8319
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12207
Inparanoid 1 1.050 109 1.000 Inparanoid score I4749
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1575179at2759
OrthoFinder 1 1.000 - - FOG0005576
OrthoInspector 1 1.000 - - oto105392
Panther 1 1.100 - - LDO PTHR22977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5217
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.