DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-c-p and CYTC-1

DIOPT Version :9

Sequence 1:NP_001285984.1 Gene:Cyt-c-p / 34996 FlyBaseID:FBgn0284248 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_173697.1 Gene:CYTC-1 / 838889 AraportID:AT1G22840 Length:114 Species:Arabidopsis thaliana


Alignment Length:104 Identity:64/104 - (61%)
Similarity:81/104 - (77%) Gaps:0/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAKGITWNEDT 68
            |.|:.:.|:|:|..:||||||||||..||.||||:||.||::|..||::|:.|||.|.:.|.|..
plant     8 PPGNAKAGEKIFRTKCAQCHTVEAGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVEWEEKA 72

  Fly    69 LFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSAT 107
            |::||.|||||||||||:|.|||||.:|.|||||||.:|
plant    73 LYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEST 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-c-pNP_001285984.1 Cytochrom_C 3..108 CDD:419674 64/104 (62%)
CYTC-1NP_173697.1 Cytochrom_C 8..111 CDD:419674 63/102 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 139 1.000 Domainoid score I1548
eggNOG 1 0.900 - - E1_COG3474
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I1748
OMA 1 1.010 - - QHG54087
OrthoDB 1 1.010 - - D1533604at2759
OrthoFinder 1 1.000 - - FOG0001342
OrthoInspector 1 1.000 - - mtm1167
orthoMCL 1 0.900 - - OOG6_101063
Panther 1 1.100 - - LDO PTHR11961
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X832
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.