DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-c-p and CYTC-1

DIOPT Version :10

Sequence 1:NP_477176.1 Gene:Cyt-c-p / 34996 FlyBaseID:FBgn0284248 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_173697.1 Gene:CYTC-1 / 838889 AraportID:AT1G22840 Length:114 Species:Arabidopsis thaliana


Alignment Length:104 Identity:64/104 - (61%)
Similarity:81/104 - (77%) Gaps:0/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAKGITWNEDT 68
            |.|:.:.|:|:|..:||||||||||..||.||||:||.||::|..||::|:.|||.|.:.|.|..
plant     8 PPGNAKAGEKIFRTKCAQCHTVEAGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVEWEEKA 72

  Fly    69 LFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSAT 107
            |::||.|||||||||||:|.|||||.:|.|||||||.:|
plant    73 LYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEST 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-c-pNP_477176.1 Cyc7 6..105 CDD:442697 61/98 (62%)
CYTC-1NP_173697.1 DHOR 8..111 CDD:473872 63/102 (62%)

Return to query results.
Submit another query.