DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-c-p and CYTC-2

DIOPT Version :9

Sequence 1:NP_001285984.1 Gene:Cyt-c-p / 34996 FlyBaseID:FBgn0284248 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_192742.1 Gene:CYTC-2 / 826595 AraportID:AT4G10040 Length:112 Species:Arabidopsis thaliana


Alignment Length:104 Identity:62/104 - (59%)
Similarity:79/104 - (75%) Gaps:0/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAKGITWNEDT 68
            |.|:.:.|:|:|..:||||||||.|..||.||||:||.||::|...|::|:.|||:..:.|.|.|
plant     8 PPGNPKAGEKIFRTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKSMAVNWEEKT 72

  Fly    69 LFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSAT 107
            |::||.|||||||||||:|.|||||.:|.|||||||..|
plant    73 LYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEGT 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-c-pNP_001285984.1 Cytochrom_C 3..108 CDD:419674 62/104 (60%)
CYTC-2NP_192742.1 Cytochrom_C 8..111 CDD:419674 61/102 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 139 1.000 Domainoid score I1548
eggNOG 1 0.900 - - E1_COG3474
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I1748
OMA 1 1.010 - - QHG54087
OrthoDB 1 1.010 - - D1533604at2759
OrthoFinder 1 1.000 - - FOG0001342
OrthoInspector 1 1.000 - - mtm1167
orthoMCL 1 0.900 - - OOG6_101063
Panther 1 1.100 - - LDO PTHR11961
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X832
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.