DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-c-p and cyct

DIOPT Version :9

Sequence 1:NP_001285984.1 Gene:Cyt-c-p / 34996 FlyBaseID:FBgn0284248 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_001008176.1 Gene:cyct / 493538 XenbaseID:XB-GENE-5931974 Length:105 Species:Xenopus tropicalis


Alignment Length:102 Identity:85/102 - (83%)
Similarity:91/102 - (89%) Gaps:0/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAKGITWNEDTLF 70
            ||||||||:|||:||||||||..||||.||||.||.|||||||.||:||||||:|||.|.|||||
 Frog     2 GDVEKGKKIFVQKCAQCHTVEKTGKHKTGPNLWGLFGRKTGQAPGFSYTDANKSKGIVWGEDTLF 66

  Fly    71 EYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSAT 107
            |||||||||||||||||||:||.|||.|||||||.:|
 Frog    67 EYLENPKKYIPGTKMIFAGIKKKNERADLIAYLKKST 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-c-pNP_001285984.1 Cytochrom_C 3..108 CDD:419674 85/102 (83%)
cyctNP_001008176.1 Cyc7 1..105 CDD:226005 85/102 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 177 1.000 Domainoid score I3531
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 184 1.000 Inparanoid score I3828
OMA 1 1.010 - - QHG54087
OrthoDB 1 1.010 - - D1533604at2759
OrthoFinder 1 1.000 - - FOG0001342
OrthoInspector 1 1.000 - - otm47978
Panther 1 1.100 - - LDO PTHR11961
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R282
SonicParanoid 1 1.000 - - X832
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.