DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-c-p and Cyt-c-d

DIOPT Version :9

Sequence 1:NP_001285984.1 Gene:Cyt-c-p / 34996 FlyBaseID:FBgn0284248 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_001260509.1 Gene:Cyt-c-d / 34995 FlyBaseID:FBgn0086907 Length:105 Species:Drosophila melanogaster


Alignment Length:105 Identity:75/105 - (71%)
Similarity:86/105 - (81%) Gaps:2/105 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAKGITWN 65
            ||  :||.|.|||:|||:||||||.|.||||||||||.|::|||.|.|||:.|||||..||:||.
  Fly     1 MG--SGDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYKYTDANIKKGVTWT 63

  Fly    66 EDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKS 105
            |..|.|||::||||||||||:||||||..||.||||:|||
  Fly    64 EGNLDEYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLKS 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-c-pNP_001285984.1 Cytochrom_C 3..108 CDD:419674 73/103 (71%)
Cyt-c-dNP_001260509.1 Cyc7 <4..103 CDD:226005 71/98 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463770
Domainoid 1 1.000 139 1.000 Domainoid score I1548
eggNOG 1 0.900 - - E1_COG3474
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I1748
Isobase 1 0.950 - 0 Normalized mean entropy S155
OMA 1 1.010 - - QHG54087
OrthoDB 1 1.010 - - D1533604at2759
OrthoFinder 1 1.000 - - FOG0001342
OrthoInspector 1 1.000 - - mtm1167
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11961
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X832
1211.860

Return to query results.
Submit another query.