DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-c-p and cyc1

DIOPT Version :9

Sequence 1:NP_001285984.1 Gene:Cyt-c-p / 34996 FlyBaseID:FBgn0284248 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_588296.1 Gene:cyc1 / 2539146 PomBaseID:SPCC191.07 Length:109 Species:Schizosaccharomyces pombe


Alignment Length:102 Identity:74/102 - (72%)
Similarity:85/102 - (83%) Gaps:0/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAKGITWNEDTLF 70
            ||.:||..||..|||||||||.||.:||||||||:.|||||||.||:||:||:.|||||:|:|||
pombe     6 GDEKKGASLFKTRCAQCHTVEKGGANKVGPNLHGVFGRKTGQAEGFSYTEANRDKGITWDEETLF 70

  Fly    71 EYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSAT 107
            .||||||||||||||.|||.|||.:|.::|.|||.||
pombe    71 AYLENPKKYIPGTKMAFAGFKKPADRNNVITYLKKAT 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-c-pNP_001285984.1 Cytochrom_C 3..108 CDD:419674 74/102 (73%)
cyc1NP_588296.1 Cyc7 1..109 CDD:226005 74/102 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 156 1.000 Domainoid score I1049
eggNOG 1 0.900 - - E1_COG3474
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I1232
OMA 1 1.010 - - QHG54087
OrthoFinder 1 1.000 - - FOG0001342
OrthoInspector 1 1.000 - - oto100832
orthoMCL 1 0.900 - - OOG6_101063
Panther 1 1.100 - - LDO PTHR11961
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R282
SonicParanoid 1 1.000 - - X832
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.