DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-c-p and Cyct

DIOPT Version :9

Sequence 1:NP_001285984.1 Gene:Cyt-c-p / 34996 FlyBaseID:FBgn0284248 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_036972.1 Gene:Cyct / 25310 RGDID:2452 Length:105 Species:Rattus norvegicus


Alignment Length:102 Identity:79/102 - (77%)
Similarity:87/102 - (85%) Gaps:0/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAKGITWNEDTLF 70
            ||.|.|||:|:|:||||||||.|||||.||||.||.|||||||.||:||||||.||:.|.|:||.
  Rat     2 GDAEAGKKIFIQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGVIWTEETLM 66

  Fly    71 EYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSAT 107
            |||||||||||||||||||:||.:||.|||.|||.||
  Rat    67 EYLENPKKYIPGTKMIFAGIKKKSEREDLIQYLKEAT 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-c-pNP_001285984.1 Cytochrom_C 3..108 CDD:419674 79/102 (77%)
CyctNP_036972.1 Cyc7 1..105 CDD:226005 79/102 (77%)
CccA <2..101 CDD:224921 76/98 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 190 1.000 Inparanoid score I3796
OMA 1 1.010 - - QHG54087
OrthoDB 1 1.010 - - D1533604at2759
OrthoFinder 1 1.000 - - FOG0001342
OrthoInspector 1 1.000 - - otm44925
orthoMCL 1 0.900 - - OOG6_101063
Panther 1 1.100 - - O PTHR11961
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X832
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.