DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-c-p and Cyct

DIOPT Version :9

Sequence 1:NP_001285984.1 Gene:Cyt-c-p / 34996 FlyBaseID:FBgn0284248 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_034119.1 Gene:Cyct / 13067 MGIID:88579 Length:105 Species:Mus musculus


Alignment Length:102 Identity:80/102 - (78%)
Similarity:88/102 - (86%) Gaps:0/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAKGITWNEDTLF 70
            ||.|.|||:|||:||||||||.|||||.||||.||.|||||||.||:||||||.||:.|:|:||.
Mouse     2 GDAEAGKKIFVQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGVIWSEETLM 66

  Fly    71 EYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSAT 107
            |||||||||||||||||||:||.:||.|||.|||.||
Mouse    67 EYLENPKKYIPGTKMIFAGIKKKSEREDLIKYLKQAT 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-c-pNP_001285984.1 Cytochrom_C 3..108 CDD:419674 80/102 (78%)
CyctNP_034119.1 Cyc7 1..105 CDD:226005 80/102 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839728
Domainoid 1 1.000 182 1.000 Domainoid score I3447
eggNOG 1 0.900 - - E1_COG3474
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 190 1.000 Inparanoid score I3873
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54087
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001342
OrthoInspector 1 1.000 - - otm42863
orthoMCL 1 0.900 - - OOG6_101063
Panther 1 1.100 - - O PTHR11961
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X832
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.