DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-c-d and CYTC-1

DIOPT Version :9

Sequence 1:NP_001260509.1 Gene:Cyt-c-d / 34995 FlyBaseID:FBgn0086907 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_173697.1 Gene:CYTC-1 / 838889 AraportID:AT1G22840 Length:114 Species:Arabidopsis thaliana


Alignment Length:101 Identity:63/101 - (62%)
Similarity:75/101 - (74%) Gaps:0/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYKYTDANIKKGVTWTEGNLD 68
            |:|:.|:|||..|||||||.|.|..||.||||.|:.||:.||.|||.|:.||..|.|.|.|..|.
plant    10 GNAKAGEKIFRTKCAQCHTVEAGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVEWEEKALY 74

  Fly    69 EYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLKSN 104
            :||.:||||||||||||.||||.::||||||:||.:
plant    75 DYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKES 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-c-dNP_001260509.1 Cyc7 <4..103 CDD:226005 62/98 (63%)
CYTC-1NP_173697.1 Cytochrom_C 8..111 CDD:419674 63/101 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 139 1.000 Domainoid score I1548
eggNOG 1 0.900 - - E1_COG3474
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I1748
OMA 1 1.010 - - QHG54087
OrthoDB 1 1.010 - - D1533604at2759
OrthoFinder 1 1.000 - - FOG0001342
OrthoInspector 1 1.000 - - mtm1167
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11961
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X832
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.