DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-c-d and RGD1562558

DIOPT Version :9

Sequence 1:NP_001260509.1 Gene:Cyt-c-d / 34995 FlyBaseID:FBgn0086907 Length:105 Species:Drosophila melanogaster
Sequence 2:XP_038949983.1 Gene:RGD1562558 / 290019 RGDID:1562558 Length:98 Species:Rattus norvegicus


Alignment Length:98 Identity:59/98 - (60%)
Similarity:71/98 - (72%) Gaps:1/98 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYKYTDANIKKGVTWTEGNLD 68
            ||.|.| |.|:||||||||.|.|||||.||||..:.|:|.|..||:.|||||..||:.|.|..|.
  Rat     2 GDVEKG-KTFIQKCAQCHTVEKGGKHKTGPNLHSLYGQKTGQVAGFSYTDANKNKGIIWGEDALM 65

  Fly    69 EYLKDPKKYIPGTKMVFAGLKKAEERADLIAFL 101
            |||::|:|:|.|.||.|||:|:..||||||.:|
  Rat    66 EYLENPQKHISGMKMFFAGIKQKGERADLIDYL 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-c-dNP_001260509.1 Cyc7 <4..103 CDD:226005 59/98 (60%)
RGD1562558XP_038949983.1 Cyc7 1..98 CDD:226005 58/96 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54087
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001342
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_155599
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X832
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.