DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-c-d and cyc1

DIOPT Version :9

Sequence 1:NP_001260509.1 Gene:Cyt-c-d / 34995 FlyBaseID:FBgn0086907 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_588296.1 Gene:cyc1 / 2539146 PomBaseID:SPCC191.07 Length:109 Species:Schizosaccharomyces pombe


Alignment Length:99 Identity:58/99 - (58%)
Similarity:71/99 - (71%) Gaps:0/99 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYKYTDANIKKGVTWTEGNLD 68
            ||.:.|..:|..:||||||.|.||.:||||||.||.|||.|.|.|:.||:||..||:||.|..|.
pombe     6 GDEKKGASLFKTRCAQCHTVEKGGANKVGPNLHGVFGRKTGQAEGFSYTEANRDKGITWDEETLF 70

  Fly    69 EYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLK 102
            .||::||||||||||.|||.||..:|.::|.:||
pombe    71 AYLENPKKYIPGTKMAFAGFKKPADRNNVITYLK 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-c-dNP_001260509.1 Cyc7 <4..103 CDD:226005 58/99 (59%)
cyc1NP_588296.1 Cyc7 1..109 CDD:226005 58/99 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3474
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54087
OrthoFinder 1 1.000 - - FOG0001342
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11961
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X832
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.