DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-c-d and Cyct

DIOPT Version :9

Sequence 1:NP_001260509.1 Gene:Cyt-c-d / 34995 FlyBaseID:FBgn0086907 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_036972.1 Gene:Cyct / 25310 RGDID:2452 Length:105 Species:Rattus norvegicus


Alignment Length:99 Identity:71/99 - (71%)
Similarity:79/99 - (79%) Gaps:0/99 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYKYTDANIKKGVTWTEGNLD 68
            ||||.|||||:||||||||.|.|||||.||||.|:.|||.|.|.|:.|||||..|||.|||..|.
  Rat     2 GDAEAGKKIFIQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGVIWTEETLM 66

  Fly    69 EYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLK 102
            |||::||||||||||:|||:||..||.|||.:||
  Rat    67 EYLENPKKYIPGTKMIFAGIKKKSEREDLIQYLK 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-c-dNP_001260509.1 Cyc7 <4..103 CDD:226005 71/99 (72%)
CyctNP_036972.1 Cyc7 1..105 CDD:226005 71/99 (72%)
CccA <2..101 CDD:224921 71/99 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54087
OrthoDB 1 1.010 - - D1533604at2759
OrthoFinder 1 1.000 - - FOG0001342
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X832
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.