DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-c-d and cyc-2.1

DIOPT Version :9

Sequence 1:NP_001260509.1 Gene:Cyt-c-d / 34995 FlyBaseID:FBgn0086907 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_001370630.1 Gene:cyc-2.1 / 177243 WormBaseID:WBGene00017121 Length:111 Species:Caenorhabditis elegans


Alignment Length:100 Identity:58/100 - (57%)
Similarity:72/100 - (72%) Gaps:1/100 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYKYTDANIKKGVTWTEGNL 67
            :||.|.|||::.|:|.|||..: ....|.||.|.||:||..||.:|:.|:.||..|||.||...|
 Worm     6 AGDYEKGKKVYKQRCLQCHVVD-STATKTGPTLHGVIGRTSGTVSGFDYSAANKNKGVVWTRETL 69

  Fly    68 DEYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLK 102
            .|||.:||||||||||||||||||:||||||.:::
 Worm    70 FEYLLNPKKYIPGTKMVFAGLKKADERADLIKYIE 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-c-dNP_001260509.1 Cyc7 <4..103 CDD:226005 58/98 (59%)
cyc-2.1NP_001370630.1 Cytochrom_C 3..109 CDD:419674 58/99 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164077
Domainoid 1 1.000 132 1.000 Domainoid score I3179
eggNOG 1 0.900 - - E1_COG3474
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I3056
Isobase 1 0.950 - 0 Normalized mean entropy S155
OMA 1 1.010 - - QHG54087
OrthoDB 1 1.010 - - D1533604at2759
OrthoFinder 1 1.000 - - FOG0001342
OrthoInspector 1 1.000 - - mtm4810
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X832
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.760

Return to query results.
Submit another query.