DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-c-d and Cyct

DIOPT Version :9

Sequence 1:NP_001260509.1 Gene:Cyt-c-d / 34995 FlyBaseID:FBgn0086907 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_034119.1 Gene:Cyct / 13067 MGIID:88579 Length:105 Species:Mus musculus


Alignment Length:99 Identity:71/99 - (71%)
Similarity:79/99 - (79%) Gaps:0/99 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYKYTDANIKKGVTWTEGNLD 68
            ||||.||||||||||||||.|.|||||.||||.|:.|||.|.|.|:.|||||..|||.|:|..|.
Mouse     2 GDAEAGKKIFVQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGVIWSEETLM 66

  Fly    69 EYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLK 102
            |||::||||||||||:|||:||..||.|||.:||
Mouse    67 EYLENPKKYIPGTKMIFAGIKKKSEREDLIKYLK 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-c-dNP_001260509.1 Cyc7 <4..103 CDD:226005 71/99 (72%)
CyctNP_034119.1 Cyc7 1..105 CDD:226005 71/99 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3474
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54087
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001342
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X832
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.