DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grp and HRK1

DIOPT Version :9

Sequence 1:NP_477011.1 Gene:grp / 34993 FlyBaseID:FBgn0261278 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_014910.1 Gene:HRK1 / 854441 SGDID:S000005793 Length:759 Species:Saccharomyces cerevisiae


Alignment Length:332 Identity:87/332 - (26%)
Similarity:124/332 - (37%) Gaps:100/332 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LAQTLGEGAYGEVKLLINRQTGEAVAMKMVDLKKHPDAANSVRK----EVCIQKMLQDKHILR-- 82
            |.:.||.||.|.||:|:....|...|:|....:|..::.....|    |.||...|...:::.  
Yeast   217 LGKLLGSGAGGSVKVLVRPTDGATFAVKEFRPRKPNESVKEYAKKCTAEFCIGSTLHHPNVIETV 281

  Fly    83 -FFGKRSQGS----VEYIFLEYAAGGELFDRIEPDVGMPQHEAQRYFTQLLSGLNYLHQRGIAHR 142
             .|....|..    :||..:::.|       :.....|.:.|......||..|:.|||..|:|||
Yeast   282 DVFSDSKQNKYYEVMEYCPIDFFA-------VVMTGKMSRGEINCCLKQLTEGVKYLHSMGLAHR 339

  Fly   143 DLKPENLLLDEHDNVKISDFGMATMFRCKGKE--RLLDKRCGTLPYVAPEVL--QKAYHAQPADL 203
            |||.:|.::.....:|:.|||.|.:||...::  .:.....|:.||:||||:  .|:|..|..|:
Yeast   340 DLKLDNCVMTSQGILKLIDFGSAVVFRYPFEDGVTMAHGIVGSDPYLAPEVITSTKSYDPQCVDI 404

  Fly   204 WSCGVILVTMLAGELPWDQPSTNCTEFTNWRDNDHWQLQTPWSKLDTLAISLLRKLLATSPGTRL 268
            ||.|:|...|:....||..|          ||:|                               
Yeast   405 WSIGIIYCCMVLKRFPWKAP----------RDSD------------------------------- 428

  Fly   269 TLEKTLDHKWCNMQFADNERSY--------DLVDSAAALE--ICSPKAKRQRL-----------Q 312
                            ||.|.|        |.|:||...|  :...|.||||.           |
Yeast   429 ----------------DNFRLYCMPDDIEHDYVESARHHEELLKERKEKRQRFLNHSDCSAINQQ 477

  Fly   313 SSAHLSN 319
            ..||.||
Yeast   478 QPAHESN 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grpNP_477011.1 STKc_Chk1 20..279 CDD:270971 68/269 (25%)
S_TKc 22..278 CDD:214567 68/268 (25%)
HRK1NP_014910.1 PKc_like 221..435 CDD:419665 70/277 (25%)
MSCRAMM_ClfB <469..673 CDD:411414 5/16 (31%)
PKc_like <677..721 CDD:419665
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.