DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grp and PTK1

DIOPT Version :9

Sequence 1:NP_477011.1 Gene:grp / 34993 FlyBaseID:FBgn0261278 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_012723.3 Gene:PTK1 / 853635 SGDID:S000001681 Length:662 Species:Saccharomyces cerevisiae


Alignment Length:402 Identity:87/402 - (21%)
Similarity:144/402 - (35%) Gaps:142/402 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QTLGEGAYGEVKLLINR-QTGEAVAMKMVDL--KKHPDA-ANSVRKEVCIQKMLQDK-HILRFF- 84
            :|:|.|...||:.:.:: :..:..|:|.:::  .:.|:. .....||..|.|.|... ||...| 
Yeast   200 KTIGWGGSCEVRKIRSKYRKKDVFALKKLNMIYNETPEKFYKRCSKEFIIAKQLSHHVHITNTFL 264

  Fly    85 ---------GKRSQGSVEYIFLEYAAGGELFDRIEPDVGMPQHEAQRY--FTQLLSGLNYLHQRG 138
                     ..|..|.|..:.|.     :||..|:.........|:::  |.|:..|:.:.|.:|
Yeast   265 LVKVPTTVYTTRGWGFVMELGLR-----DLFAMIQKSGWRSVALAEKFCIFKQVACGVKFCHDQG 324

  Fly   139 IAHRDLKPENLLLDEHDNVKISDFGMATMF------------RCKGKERLLDKRCGTLPYVAPEV 191
            ||||||||||:||......|::|||::..:            :|.|       ..|:.||..|||
Yeast   325 IAHRDLKPENVLLSPDGVCKLTDFGISDWYHTDPHDLSSPVKKCAG-------MIGSPPYAPPEV 382

  Fly   192 ------------LQKAYHAQPADLWSCGVILVTMLAGELPWDQPSTNCTEFTNWRD--------- 235
                        ||:.|..:..|.:..|:||:|::...:|:.:   :|:..|.:||         
Yeast   383 MFYDSKKHYDTELQQPYDPRALDCYGLGIILMTLVNNVIPFLE---SCSFDTGFRDYCDAYENFI 444

  Fly   236 ----------------------------NDH-----WQLQTPWSKLDTLAISLLRKLLATSPGTR 267
                                        |.|     |:|..|                  ...||
Yeast   445 RLHDRAFRNRGNYRPGPGMEYHLARNFKNGHASRVAWRLADP------------------EAATR 491

  Fly   268 LTLEKTLDHKW---------CNMQFA-----------DNERSYDL-VDSAAALEICSPKAK---- 307
            .|::...:..|         .|.::.           :|.|.:.: .|.||.....:|..|    
Yeast   492 YTIDDLFEDPWFQGIETCVDANDKYVCKKPIIKTTTYENPRGFHIATDVAATTPTSNPFLKNRVP 556

  Fly   308 -RQRLQSSAHLS 318
             |..:..:||.|
Yeast   557 IRSMVDIAAHPS 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grpNP_477011.1 STKc_Chk1 20..279 CDD:270971 75/344 (22%)
S_TKc 22..278 CDD:214567 74/334 (22%)
PTK1NP_012723.3 PKc_like 202..503 CDD:419665 73/333 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.