DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grp and RTK1

DIOPT Version :9

Sequence 1:NP_477011.1 Gene:grp / 34993 FlyBaseID:FBgn0261278 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_010259.1 Gene:RTK1 / 851536 SGDID:S000002183 Length:620 Species:Saccharomyces cerevisiae


Alignment Length:340 Identity:95/340 - (27%)
Similarity:159/340 - (46%) Gaps:48/340 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EFVEGWTL-AQTLGEGAYGEVKLLINRQTGEAVAMKMVDLKKH--------PDAANSVRK---EV 69
            |.:|.:.: .:.|||||.|.|. ::.|..|:..|.||. .|.|        ...||..:|   |.
Yeast   296 ELLEKYGIPGRKLGEGASGSVS-VVERTDGKLFACKMF-RKPHLNNEGTNQSQLANYSKKVTTEF 358

  Fly    70 CIQKMLQDKHILRFFGKRSQGSVEYIFLEYAAGGELFDRIEPDVGMPQHEAQRYFTQLLSGLNYL 134
            ||...|..::|:......::|....:.:|||. .:.|:.:..:: |.|.|...||.||..|:|||
Yeast   359 CIGSTLHHENIVETLDMLTEGDTYLLVMEYAP-YDFFNLVMSNL-MTQDEVNCYFKQLCHGVNYL 421

  Fly   135 HQRGIAHRDLKPENLLLDEHDNVKISDFGMATMFRCKGKERLLDKR--CGTLPYVAPEVL-QKAY 196
            |..|:||||||.:|.::.:...:|:.|||.|.:|:...::.::...  .|:.||:|||:| |.:|
Yeast   422 HSMGLAHRDLKLDNCVVTKDGILKLIDFGSAVVFQYPYEDTIVKSHGIVGSDPYLAPELLKQTSY 486

  Fly   197 HAQPADLWSCGVILVTMLAGELPWDQPSTNCTE---FTNWRDNDHWQLQTPWSKLDTL---AISL 255
            ..:.||:||..:|...|:....||..|..:...   ||...:::...::.|...|..|   :.::
Yeast   487 DPRVADVWSIAIIFYCMVLKRFPWKAPKKSFNSFRLFTEEPEDEDDIVRGPNKILRLLPRHSRTI 551

  Fly   256 LRKLLATSPGTRLTLEKTLDHKW------CNMQFADNERSYDLVDSAAALEICSPKAKRQRLQSS 314
            :.::||..|..|:.:...:...|      |.:    :..|.|||:        .||..:..|.:.
Yeast   552 IGRMLALEPKQRVLMNDVVKDDWLVSVPSCEV----DPTSGDLVE--------KPKNHKHHLVTE 604

  Fly   315 AHLS-----NGLDDS 324
            ..|:     :|..||
Yeast   605 EELNELTKQHGNKDS 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grpNP_477011.1 STKc_Chk1 20..279 CDD:270971 82/285 (29%)
S_TKc 22..278 CDD:214567 80/276 (29%)
RTK1NP_010259.1 STKc_HAL4_like 308..575 CDD:270896 80/270 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.