DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grp and SNRK2-8

DIOPT Version :9

Sequence 1:NP_477011.1 Gene:grp / 34993 FlyBaseID:FBgn0261278 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001077839.1 Gene:SNRK2-8 / 844164 AraportID:AT1G78290 Length:343 Species:Arabidopsis thaliana


Alignment Length:272 Identity:93/272 - (34%)
Similarity:144/272 - (52%) Gaps:25/272 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VEGWTLAQTLGEGAYGEVKLLINRQTGEAVAMKMVDLKKHPDAANSVRKEVCIQKMLQDKHILRF 83
            :|.:.:.:.:|.|.:|..||:.::.:.|..|:|.::..:..|  ..|::|:...:.|...:|:||
plant     1 MERYEIVKDIGSGNFGVAKLVRDKFSKELFAVKFIERGQKID--EHVQREIMNHRSLIHPNIIRF 63

  Fly    84 FGKRSQGSVEYIFLEYAAGGELFDRIEPDVGMPQHEAQRYFTQLLSGLNYLHQRGIAHRDLKPEN 148
            .......:...:.:|||||||||.||.......:.||:.:|.||:||:||.|...|.|||||.||
plant    64 KEVLLTATHLALVMEYAAGGELFGRICSAGRFSEDEARFFFQQLISGVNYCHSLQICHRDLKLEN 128

  Fly   149 LLLD--EHDNVKISDFGMATMFRCKGKERLLDKR----CGTLPYVAPEVLQ-KAYHAQPADLWSC 206
            .|||  |...|||.|||.:       |..:|..:    .||..|:|||||. |.|..:.||:|||
plant   129 TLLDGSEAPRVKICDFGYS-------KSGVLHSQPKTTVGTPAYIAPEVLSTKEYDGKIADVWSC 186

  Fly   207 GVILVTMLAGELPWDQPSTNCTEFTNWRDNDHWQLQTPWSKLDTLAIS-----LLRKLLATSPGT 266
            ||.|..||.|..|::.||    :..::|......|:..::..|.:.:|     ||.::...:|..
plant   187 GVTLYVMLVGAYPFEDPS----DPKDFRKTIGRILKAQYAIPDYVRVSDECRHLLSRIFVANPEK 247

  Fly   267 RLTLEKTLDHKW 278
            |:|:|:..:|.|
plant   248 RITIEEIKNHSW 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grpNP_477011.1 STKc_Chk1 20..279 CDD:270971 93/271 (34%)
S_TKc 22..278 CDD:214567 91/267 (34%)
SNRK2-8NP_001077839.1 STKc_SnRK2 3..259 CDD:271132 91/268 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24343
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.