DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grp and CIPK9

DIOPT Version :9

Sequence 1:NP_477011.1 Gene:grp / 34993 FlyBaseID:FBgn0261278 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_849571.1 Gene:CIPK9 / 839349 AraportID:AT1G01140 Length:451 Species:Arabidopsis thaliana


Alignment Length:515 Identity:139/515 - (26%)
Similarity:240/515 - (46%) Gaps:119/515 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ATREFVEGWTLAQTLGEGAYGEVKLLINRQTGEAVAMKMVDLKK--HPDAANSVRKEVCIQKMLQ 76
            |:|..|..:.:.:|||||::.:||...|..||:..|:|::|.:|  .......:::|:...|:::
plant    11 ASRTRVGNYEMGRTLGEGSFAKVKYAKNTVTGDQAAIKILDREKVFRHKMVEQLKREISTMKLIK 75

  Fly    77 DKHILRFFGKRSQGSVEYIFLEYAAGGELFDRIEPDVGMPQHEAQRYFTQLLSGLNYLHQRGIAH 141
            ..:::......:..:..||.||...||||||:|.....:.:.||:|||.||::.::|.|.||:.|
plant    76 HPNVVEIIEVMASKTKIYIVLELVNGGELFDKIAQQGRLKEDEARRYFQQLINAVDYCHSRGVYH 140

  Fly   142 RDLKPENLLLDEHDNVKISDFGMATMFRCKGKERLLDKRCGTLPYVAPEVL-QKAYHAQPADLWS 205
            ||||||||:||.:..:|:||||::...|...::.||...|||..||||||| .|.|....||:||
plant   141 RDLKPENLILDANGVLKVSDFGLSAFSRQVREDGLLHTACGTPNYVAPEVLSDKGYDGAAADVWS 205

  Fly   206 CGVILVTMLAGELPWDQPSTN------C-TEFTNWRDNDHWQLQTPWSKLDTLAISLLRKLLATS 263
            |||||..::||.||:|:|:..      | .||:          ..||  ....|..:::::|..:
plant   206 CGVILFVLMAGYLPFDEPNLMTLYKRICKAEFS----------CPPW--FSQGAKRVIKRILEPN 258

  Fly   264 PGTRLTLEKTLDHKWCNMQFADNERSYDLVDSAAALEICSPKAKRQRLQSSAHLSNGLDDSISRN 328
            |.||:::.:.|:.:|                                              ..:.
plant   259 PITRISIAELLEDEW----------------------------------------------FKKG 277

  Fly   329 YCSQPMPTMRSDDDFNVRLGSGRSKEDGGDRQTLAQEARLSYSFSQPALLDDLLLATQMNQTQNA 393
            |  :|....:.|:|..:        :|.....:.::|..::....:|..::...|.:  :.::.:
plant   278 Y--KPPSFDQDDEDITI--------DDVDAAFSNSKECLVTEKKEKPVSMNAFELIS--SSSEFS 330

  Fly   394 SQNYFQR---LVRRMTRFF-------VTTRWDDTIKRLVGTIERLGGYTCKF-----GDDGVVTV 443
            .:|.|::   ||::.|||.       :.::.::|.|.| |...|...|..|.     |..|.::|
plant   331 LENLFEKQAQLVKKETRFTSQRSASEIMSKMEETAKPL-GFNVRKDNYKIKMKGDKSGRKGQLSV 394

  Fly   444 STVDRNKLRLVFKA----HIIEMDGKILVDCRLSKGCGLEFKR---RFIK-IKNALEDIV 495
            :|.       ||:.    |::|:        |.:.|..|||.:   .|.| ..:.|:|:|
plant   395 ATE-------VFEVAPSLHVVEL--------RKTGGDTLEFHKVCDSFYKNFSSGLKDVV 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grpNP_477011.1 STKc_Chk1 20..279 CDD:270971 95/268 (35%)
S_TKc 22..278 CDD:214567 95/265 (36%)
CIPK9NP_849571.1 S_TKc 19..274 CDD:214567 96/312 (31%)
STKc_SnRK3 19..273 CDD:271133 95/265 (36%)
CIPK_C 318..437 CDD:213380 31/136 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 209 1.000 Inparanoid score I1258
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001125
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.