DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grp and SNRK2.3

DIOPT Version :9

Sequence 1:NP_477011.1 Gene:grp / 34993 FlyBaseID:FBgn0261278 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001318893.1 Gene:SNRK2.3 / 836822 AraportID:AT5G66880 Length:361 Species:Arabidopsis thaliana


Alignment Length:340 Identity:103/340 - (30%)
Similarity:163/340 - (47%) Gaps:34/340 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WTLAQTLGEGAYGEVKLLINRQTGEAVAMKMVDLKKHPDAANSVRKEVCIQKMLQDKHILRFFGK 86
            :...:.:|.|.:|..:|:.::.|.|.||:|.::.....|  .:|::|:...:.|:..:|:||...
plant    22 YDFVKDIGSGNFGVARLMRDKLTKELVAVKYIERGDKID--ENVQREIINHRSLRHPNIVRFKEV 84

  Fly    87 RSQGSVEYIFLEYAAGGELFDRIEPDVGMPQHEAQRYFTQLLSGLNYLHQRGIAHRDLKPENLLL 151
            ....:...|.:|||:||||::||.......:.||:.:|.|||||::|.|...|.|||||.||.||
plant    85 ILTPTHLAIIMEYASGGELYERICNAGRFSEDEARFFFQQLLSGVSYCHSMQICHRDLKLENTLL 149

  Fly   152 D--EHDNVKISDFGMATMFRCKGKERLLDKR----CGTLPYVAPEV-LQKAYHAQPADLWSCGVI 209
            |  ....:||.|||.:       |..:|..:    .||..|:|||| |::.|..:.||:|||||.
plant   150 DGSPAPRLKICDFGYS-------KSSVLHSQPKSTVGTPAYIAPEVLLRQEYDGKIADVWSCGVT 207

  Fly   210 LVTMLAGELPWDQPSTNCTEFTNWRDNDHWQLQTPWSKLDTLAIS-----LLRKLLATSPGTRLT 269
            |..||.|..|::.|.    |..::|......|...:|..|.:.||     |:.::....|.||::
plant   208 LYVMLVGAYPFEDPE----EPRDYRKTIQRILSVKYSIPDDIRISPECCHLISRIFVADPATRIS 268

  Fly   270 LEKTLDHKWCNMQFADNERSYDLVDSAAALEICSPKAKRQRLQSSAHLSNGLDDSISRNYCSQPM 334
            :.:...|.|    |..|..:..:.:|....:...|:...|.|.:...:.:.......||.|....
plant   269 IPEIKTHSW----FLKNLPADLMNESNTGSQFQEPEQPMQSLDTIMQIISEATIPAVRNRCLDDF 329

  Fly   335 PTMRSD-----DDFN 344
            .|...|     |||:
plant   330 MTDNLDLDDDMDDFD 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grpNP_477011.1 STKc_Chk1 20..279 CDD:270971 88/268 (33%)
S_TKc 22..278 CDD:214567 88/267 (33%)
SNRK2.3NP_001318893.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24343
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.