DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grp and CIPK21

DIOPT Version :9

Sequence 1:NP_477011.1 Gene:grp / 34993 FlyBaseID:FBgn0261278 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_568860.1 Gene:CIPK21 / 835868 AraportID:AT5G57630 Length:416 Species:Arabidopsis thaliana


Alignment Length:360 Identity:99/360 - (27%)
Similarity:168/360 - (46%) Gaps:63/360 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WTLAQTLGEGAYGEVKLLINRQTGEAVAMKMVD--LKKHPDAANSVRKEVCIQKMLQDKHILRFF 84
            :.:.:|:|||.:.:|||..:...|..||:|::|  |.......:.|::|:...|:|...:|::..
plant    12 YEIGRTIGEGNFAKVKLGYDTTNGTYVAVKIIDKALVIQKGLESQVKREIRTMKLLNHPNIVQIH 76

  Fly    85 GKRSQGSVEYIFLEYAAGGELFDRIEPDVGMPQHEAQRYFTQLLSGLNYLHQRGIAHRDLKPENL 149
            ......:...|.:||.:||:|.||:... .|.:.:|::.|.||:..::|.|.||:.||||||:||
plant    77 EVIGTKTKICIVMEYVSGGQLSDRLGRQ-KMKESDARKLFQQLIDAVDYCHNRGVYHRDLKPQNL 140

  Fly   150 LLDEHDNVKISDFGMATMFRCKGKERLLDKRCGTLPYVAPE-VLQKAYHAQPADLWSCGVILVTM 213
            |||...|:|:||||::.:.:   ...:|...||:..|:||| ::.|.|.....|:|||||||..:
plant   141 LLDSKGNLKVSDFGLSAVPK---SGDMLSTACGSPCYIAPELIMNKGYSGAAVDVWSCGVILFEL 202

  Fly   214 LAGELPWDQPSTNCTEFTNWRDNDHWQLQTPWSKLDTLAISLLR------------------KLL 260
            |||..|:|               ||        .|..|...:||                  .:|
plant   203 LAGYPPFD---------------DH--------TLPVLYKKILRADYTFPPGFTGEQKRLIFNIL 244

  Fly   261 ATSPGTRLTL-EKTLDHKWCNMQFAD--NERSYDLVDSAAALEICSPKAKRQRLQSSAHLSNGLD 322
            ..:|.:|:|| |..:...|..:.:..  ::.|..:.|:.|.:...:..:..........:|:.||
plant   245 DPNPLSRITLAEIIIKDSWFKIGYTPVYHQLSDSIKDNVAEINAATASSNFINAFQIIAMSSDLD 309

  Fly   323 DSISRNYCSQPMPTMRSDDD--FNVRLGSGRSKED 355
            .|          .....:||  :..|:||..:.::
plant   310 LS----------GLFEENDDKRYKTRIGSKNTAQE 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grpNP_477011.1 STKc_Chk1 20..279 CDD:270971 86/278 (31%)
S_TKc 22..278 CDD:214567 86/277 (31%)
CIPK21NP_568860.1 PKc_like 11..263 CDD:419665 86/277 (31%)
CIPK_C 297..411 CDD:213380 9/48 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 209 1.000 Inparanoid score I1258
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.