DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grp and CIPK20

DIOPT Version :9

Sequence 1:NP_477011.1 Gene:grp / 34993 FlyBaseID:FBgn0261278 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_199394.1 Gene:CIPK20 / 834622 AraportID:AT5G45820 Length:439 Species:Arabidopsis thaliana


Alignment Length:487 Identity:136/487 - (27%)
Similarity:231/487 - (47%) Gaps:87/487 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WTLAQTLGEGAYGEVKLLINRQTGEAVAMKMVDLKKHPDAA--NSVRKEVCIQKMLQDKHILRFF 84
            :.|.:.||:|.:.:|....|.:|||:||:|::|.:|.....  :.:::|:.:.::::..|::...
plant    12 YELGRLLGQGTFAKVYHARNIKTGESVAIKVIDKQKVAKVGLIDQIKREISVMRLVRHPHVVFLH 76

  Fly    85 GKRSQGSVEYIFLEYAAGGELFDRIEPDVGMPQHEAQRYFTQLLSGLNYLHQRGIAHRDLKPENL 149
            ...:..:..|..:||..||||||::... .:.::.|::||.||:..::|.|.||:.|||||||||
plant    77 EVMASKTKIYFAMEYVKGGELFDKVSKG-KLKENIARKYFQQLIGAIDYCHSRGVYHRDLKPENL 140

  Fly   150 LLDEHDNVKISDFGMATMFRCKGKERLLDKRCGTLPYVAPEVL-QKAYHAQPADLWSCGVILVTM 213
            ||||:.::||||||::.:...|.::.||...|||..||||||: :|.|....||:|||||:|..:
plant   141 LLDENGDLKISDFGLSALRESKQQDGLLHTTCGTPAYVAPEVIGKKGYDGAKADVWSCGVVLYVL 205

  Fly   214 LAGELPWDQPSTNCTEFTNWRDNDHWQLQTP-WSKLDTLAISLLRKLLATSPGTRLTLEKTLDHK 277
            |||.||:.:  .|..|.  :|.....:.:.| |...:..  .||.::|..:|.:|:.:||.:::.
plant   206 LAGFLPFHE--QNLVEM--YRKITKGEFKCPNWFPPEVK--KLLSRILDPNPNSRIKIEKIMENS 264

  Fly   278 WCNMQFADNERSYDLVDSAAALEICSPKAKRQRLQSSAHLSNGLDDSISRNYCSQPMPTMRSDDD 342
            |....|.               :|.:||:      ..:|..:.|...:...:..:||.....|  
plant   265 WFQKGFK---------------KIETPKS------PESHQIDSLISDVHAAFSVKPMSYNAFD-- 306

  Fly   343 FNVRLGSGRSKEDGGDRQTLAQEARLSYSFSQPALLDDLLLATQMNQTQNASQNYFQRLVRRMTR 407
                                     |..|.||...|..|                |::..|..::
plant   307 -------------------------LISSLSQGFDLSGL----------------FEKEERSESK 330

  Fly   408 FFVTTRWDDTIKRLVGTIERLGGYTCKF----GDDGVVTVSTVDRNKLRLVFKAHIIEMDGKI-L 467
            |  ||:.|  .|.:|...|.:...:.:|    .|.||......:..|..|.....|.|:.... :
plant   331 F--TTKKD--AKEIVSKFEEIATSSERFNLTKSDVGVKMEDKREGRKGHLAIDVEIFEVTNSFHM 391

  Fly   468 VDCRLSKGCGLEFKRRFI--KIKNALEDIVLK 497
            |:.:.|.|..:|:| :|.  :::.:|:|||.|
plant   392 VEFKKSGGDTMEYK-QFCDRELRPSLKDIVWK 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grpNP_477011.1 STKc_Chk1 20..279 CDD:270971 92/260 (35%)
S_TKc 22..278 CDD:214567 92/259 (36%)
CIPK20NP_199394.1 STKc_SnRK3 11..265 CDD:271133 92/259 (36%)
S_TKc 12..266 CDD:214567 92/260 (35%)
CIPK_C 303..417 CDD:213380 30/161 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 209 1.000 Inparanoid score I1258
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.