DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grp and CIPK15

DIOPT Version :9

Sequence 1:NP_477011.1 Gene:grp / 34993 FlyBaseID:FBgn0261278 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001031820.1 Gene:CIPK15 / 830556 AraportID:AT5G01810 Length:421 Species:Arabidopsis thaliana


Alignment Length:427 Identity:118/427 - (27%)
Similarity:202/427 - (47%) Gaps:86/427 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WTLAQTLGEGAYGEVKLLINRQTGEAVAMKMVDLKK--HPDAANSVRKEVCIQKMLQDKHILRFF 84
            :.:.:.||:|.:.:|....:.:||::||:|::|.::  .......:::|:...::|:..:|:...
plant    12 YEVGKFLGQGTFAKVYHARHLKTGDSVAIKVIDKERILKVGMTEQIKREISAMRLLRHPNIVELH 76

  Fly    85 GKRSQGSVEYIFLEYAAGGELFDRIEPDVGMPQHEAQRYFTQLLSGLNYLHQRGIAHRDLKPENL 149
            ...:..|..|..:|:..|||||:::... .:.:..|::||.||:..:::.|.||:.|||||||||
plant    77 EVMATKSKIYFVMEHVKGGELFNKVSTG-KLREDVARKYFQQLVRAVDFCHSRGVCHRDLKPENL 140

  Fly   150 LLDEHDNVKISDFGMATMFRCKGKERLLDKRCGTLPYVAPEVLQK-AYHAQPADLWSCGVILVTM 213
            |||||.|:||||||::.:...:.::.||...|||..||||||:.: .|....||:|||||||..:
plant   141 LLDEHGNLKISDFGLSALSDSRRQDGLLHTTCGTPAYVAPEVISRNGYDGFKADVWSCGVILFVL 205

  Fly   214 LAGELPWDQPSTNCTE-----------FTNWRDNDHWQLQTPWSKLDTLAISLLRKLLATSPGTR 267
            |||.||:  ..:|..|           |.||        ..|.:|      .||:::|..:|.||
plant   206 LAGYLPF--RDSNLMELYKKIGKAEVKFPNW--------LAPGAK------RLLKRILDPNPNTR 254

  Fly   268 LTLEKTLDHKW----CNMQFADNERSYDLVDSAAALEICSPKAKRQRLQSSA----HLSNGLDDS 324
            ::.||.:...|    ...:..::......||:.|.....:.|.|::.:..:|    .||.|.|.|
plant   255 VSTEKIMKSSWFRKGLQEEVKESVEEETEVDAEAEGNASAEKEKKRCINLNAFEIISLSTGFDLS 319

  Fly   325 --------------ISRNYCSQ------------PMPTMRSDDDFNVRLGSGRS----------- 352
                          .|....|:            .|...:.:.::.|::.:..:           
plant   320 GLFEKGEEKEEMRFTSNREASEITEKLVEIGKDLKMKVRKKEHEWRVKMSAEATVVEAEVFEIAP 384

  Fly   353 -------KEDGGDRQTLAQEARLSYSFSQPALLDDLL 382
                   |:.|||   .|:..|:.....:|||:|.:|
plant   385 SYHMVVLKKSGGD---TAEYKRVMKESIRPALIDFVL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grpNP_477011.1 STKc_Chk1 20..279 CDD:270971 92/274 (34%)
S_TKc 22..278 CDD:214567 91/269 (34%)
CIPK15NP_001031820.1 STKc_SnRK3 11..265 CDD:271133 91/269 (34%)
S_TKc 12..266 CDD:214567 91/270 (34%)
CIPK_C 305..413 CDD:213380 17/110 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 209 1.000 Inparanoid score I1258
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.