DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grp and SIP3

DIOPT Version :9

Sequence 1:NP_477011.1 Gene:grp / 34993 FlyBaseID:FBgn0261278 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_194825.1 Gene:SIP3 / 829221 AraportID:AT4G30960 Length:441 Species:Arabidopsis thaliana


Alignment Length:411 Identity:134/411 - (32%)
Similarity:201/411 - (48%) Gaps:58/411 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAATLTEAGTGPAATREFVEG-WTLAQTLGEGAYGEVKLLINRQTGEAVAMKMVDLKK--HPDAA 62
            :.|...|.|:...::...:.| :.|.:.||.|.:.:|....|.|||::||||:|..:|  .....
plant     2 VGAKPVENGSDGGSSTGLLHGRYELGRLLGHGTFAKVYHARNIQTGKSVAMKVVGKEKVVKVGMV 66

  Fly    63 NSVRKEVCIQKMLQDKHILRFFGKRSQGSVEYIFLEYAAGGELF-----DRIEPDVGMPQHEAQR 122
            :.:::|:.:.:|::..:|:......:..|..|..:|...|||||     .|:..||      |:.
plant    67 DQIKREISVMRMVKHPNIVELHEVMASKSKIYFAMELVRGGELFAKVAKGRLREDV------ARV 125

  Fly   123 YFTQLLSGLNYLHQRGIAHRDLKPENLLLDEHDNVKISDFGMATMFRCKGKERLLDKRCGTLPYV 187
            ||.||:|.:::.|.||:.|||||||||||||..|:|::|||::.......::.||...|||..||
plant   126 YFQQLISAVDFCHSRGVYHRDLKPENLLLDEEGNLKVTDFGLSAFTEHLKQDGLLHTTCGTPAYV 190

  Fly   188 APEV-LQKAYHAQPADLWSCGVILVTMLAGELPW-DQPSTNCTEFTNWRDNDHWQLQTP-WSKLD 249
            |||| |:|.|....||||||||||..:|||.||: |....|.     :|.......:.| |...|
plant   191 APEVILKKGYDGAKADLWSCGVILFVLLAGYLPFQDDNLVNM-----YRKIYRGDFKCPGWLSSD 250

  Fly   250 TLAISLLRKLLATSPGTRLTLEKTLDHKWCNMQFADNERSYDLVDSAAALE------ICSPKAKR 308
              |..|:.|||..:|.||:|:||.:|..|...| |...|:..:..:....|      :...|.:.
plant   251 --ARRLVTKLLDPNPNTRITIEKVMDSPWFKKQ-ATRSRNEPVAATITTTEEDVDFLVHKSKEET 312

  Fly   309 QRLQSSAH---LSNGLDDS------------ISRNYCSQPMPTM--------RSDDDFNVRLGSG 350
            :.| ::.|   ||.|.|.|            ..|...|:|..::        |..:.|:||....
plant   313 ETL-NAFHIIALSEGFDLSPLFEEKKKEEKREMRFATSRPASSVISSLEEAARVGNKFDVRKSES 376

  Fly   351 RSKEDG---GDRQTLAQEARL 368
            |.:.:|   |.:..||.||.:
plant   377 RVRIEGKQNGRKGKLAVEAEI 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grpNP_477011.1 STKc_Chk1 20..279 CDD:270971 104/269 (39%)
S_TKc 22..278 CDD:214567 103/265 (39%)
SIP3NP_194825.1 PKc_like 23..277 CDD:419665 103/266 (39%)
CIPK_C 316..432 CDD:213380 20/82 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 209 1.000 Inparanoid score I1258
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.