DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grp and CIPK8

DIOPT Version :9

Sequence 1:NP_477011.1 Gene:grp / 34993 FlyBaseID:FBgn0261278 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_194171.1 Gene:CIPK8 / 828542 AraportID:AT4G24400 Length:445 Species:Arabidopsis thaliana


Alignment Length:509 Identity:144/509 - (28%)
Similarity:234/509 - (45%) Gaps:119/509 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WTLAQTLGEGAYGEVKLLINRQTGEAVAMKMVD----LKKHPDAANSVRKEVCIQKMLQDKHILR 82
            :.|.:|:|||.:.:||...|.:|||:||||:||    :|:  ...:.:::|:.|.|:::...::|
plant     9 YELGRTIGEGTFAKVKFAQNTETGESVAMKIVDRSTIIKR--KMVDQIKREISIMKLVRHPCVVR 71

  Fly    83 FFGKRSQGSVEYIFLEYAAGGELFDRIEPDVGMPQHEAQRYFTQLLSGLNYLHQRGIAHRDLKPE 147
            .:...:..:..||.|||..||||||:|..:..:.:.||::||.||:.|::|.|.:|:.|||||||
plant    72 LYEVLASRTKIYIILEYITGGELFDKIVRNGRLSESEARKYFHQLIDGVDYCHSKGVYHRDLKPE 136

  Fly   148 NLLLDEHDNVKISDFGMATMFRCKGKER---LLDKRCGTLPYVAPEVL-QKAYHAQPADLWSCGV 208
            |||||...|:||||||::.:     .|:   :|...|||..||||||| .|.|:...||:|||||
plant   137 NLLLDSQGNLKISDFGLSAL-----PEQGVTILKTTCGTPNYVAPEVLSHKGYNGAVADIWSCGV 196

  Fly   209 ILVTMLAGELPWDQPSTNCTEFTNWRDNDHWQLQTPWSKLDTL-----------AISLLRKLLAT 262
            ||..::||.||:|:                ..|.|.:||:|..           |.||:.::|..
plant   197 ILYVLMAGYLPFDE----------------MDLPTLYSKIDKAEFSCPSYFALGAKSLINRILDP 245

  Fly   263 SPGTRLTLEKTLDHKWCNMQFADNERSYDLVDSAAALEICSPKAKRQRLQSSAHLSNGLDDSISR 327
            :|.||:|:.:....:|    |..:.....|:|                   ..|::  |||..  
plant   246 NPETRITIAEIRKDEW----FLKDYTPVQLID-------------------YEHVN--LDDVY-- 283

  Fly   328 NYCSQPMPTMRSDDDFNVRLGSGRSKEDGGDRQTLAQEARLS------YSFSQPALLDDLLLATQ 386
                                    :..|..:.||.||:....      .:|....|...|.|||.
plant   284 ------------------------AAFDDPEEQTYAQDGTRDTGPLTLNAFDLIILSQGLNLATL 324

  Fly   387 MNQTQNASQNYFQRLVRRMTRFF------VTTRWDDTIKRLVGTIERLGGYTCKFGDDGVVTVST 445
            .::.:::        ::..|||.      |.....:.:.:.:|....:..|  |...:|:....|
plant   325 FDRGKDS--------MKHQTRFISHKPANVVLSSMEVVSQSMGFKTHIRNY--KMRVEGLSANKT 379

  Fly   446 VDRNKLRLVFKAHIIEMDGKILVDCRLSKGCGLEFKRRFIKIKNALEDIVLKGP 499
            ...:.:..|||.    ....::||.:.:.|...|:.:.:....:.|:||:.|.|
plant   380 SHFSVILEVFKV----APSILMVDIQNAAGDAEEYLKFYKTFCSKLDDIIWKPP 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grpNP_477011.1 STKc_Chk1 20..279 CDD:270971 104/275 (38%)
S_TKc 22..278 CDD:214567 104/274 (38%)
CIPK8NP_194171.1 PKc_like 8..261 CDD:419665 104/274 (38%)
CIPK_C 308..423 CDD:213380 23/128 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 209 1.000 Inparanoid score I1258
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001125
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.