DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grp and KIN10

DIOPT Version :9

Sequence 1:NP_477011.1 Gene:grp / 34993 FlyBaseID:FBgn0261278 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_850488.1 Gene:KIN10 / 821259 AraportID:AT3G01090 Length:535 Species:Arabidopsis thaliana


Alignment Length:397 Identity:119/397 - (29%)
Similarity:183/397 - (46%) Gaps:50/397 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AGTGP-AATREFVEGWTLAQTLGEGAYGEVKLLINRQTGEAVAMKMVDLK--KHPDAANSVRKEV 69
            :|||. :.....:..:.|.:|||.|::|.||:..:..||..||:|:::.:  |:.:....||:|:
plant    27 SGTGSRSGVESILPNYKLGRTLGIGSFGRVKIAEHALTGHKVAIKILNRRKIKNMEMEEKVRREI 91

  Fly    70 CIQKMLQDKHILRFFGKRSQGSVEYIFLEYAAGGELFDRIEPDVGMPQHEAQRYFTQLLSGLNYL 134
            .|.::....||:|.:......:..|:.:||...|||||.|.....:.:.||:.:|.|::||:.|.
plant    92 KILRLFMHPHIIRLYEVIETPTDIYLVMEYVNSGELFDYIVEKGRLQEDEARNFFQQIISGVEYC 156

  Fly   135 HQRGIAHRDLKPENLLLDEHDNVKISDFGMATMFRCKGKERLLDKRCGTLPYVAPEVLQ-KAYHA 198
            |:..:.||||||||||||...||||:|||::.:.|   ....|...||:..|.||||:. |.|..
plant   157 HRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMR---DGHFLKTSCGSPNYAAPEVISGKLYAG 218

  Fly   199 QPADLWSCGVILVTMLAGELPWDQPSTNCTEFTNWRDNDHWQLQTPWSKLDTLAISLLRKLLATS 263
            ...|:|||||||..:|.|.||:|..:     ..|........:.|..|.|...|..|:.::|...
plant   219 PEVDVWSCGVILYALLCGTLPFDDEN-----IPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVD 278

  Fly   264 PGTRLTLEKTLDHKWCNMQFADNERSY------DLVDSAAALEICSPKAKRQRLQSSAHLSNGLD 322
            |..|:|:.:...|.|    |..:...|      |.|..|       .|...:.||...::  |.|
plant   279 PMKRVTIPEIRQHPW----FQAHLPRYLAVPPPDTVQQA-------KKIDEEILQEVINM--GFD 330

  Fly   323 DSISRNYCSQPMPTMRSDD---------DFNVRLGSG------RSKEDGGDRQTLAQEARLSYSF 372
                ||:..:.:.....:|         |...|..||      :...:|..|...|:......|.
plant   331 ----RNHLIESLRNRTQNDGTVTYYLILDNRFRASSGYLGAEFQETMEGTPRMHPAESVASPVSH 391

  Fly   373 SQPALLD 379
            ..|.|::
plant   392 RLPGLME 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grpNP_477011.1 STKc_Chk1 20..279 CDD:270971 92/261 (35%)
S_TKc 22..278 CDD:214567 92/258 (36%)
KIN10NP_850488.1 STKc_AMPK_alpha 39..294 CDD:270981 93/266 (35%)
S_TKc 42..294 CDD:214567 93/263 (35%)
UBA_SnRK1_plant 316..356 CDD:270520 7/45 (16%)
AMPKA_C 411..532 CDD:213378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24343
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.