DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grp and CG14305

DIOPT Version :9

Sequence 1:NP_477011.1 Gene:grp / 34993 FlyBaseID:FBgn0261278 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster


Alignment Length:289 Identity:86/289 - (29%)
Similarity:141/289 - (48%) Gaps:17/289 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AATLTEAGTGPAATREFVE-GWTLAQTLGEGAYGEV---KLLINRQTGEAVAMKMVDLKKHP-DA 61
            :|.:.:.||..:......: |:.:...:|||:|..|   ....:...|..:|.|::|..|.| |.
  Fly     7 SAGIRQLGTRSSDVDALAQRGYNVGHKIGEGSYATVITAGYADDHGHGVHLACKIIDKAKAPTDF 71

  Fly    62 ANS-VRKEVCIQKMLQDKHILRFFGKRSQGSVEYIFLEYAAGGELFDRIEPDVGMPQHEAQRYFT 125
            .|. ..:|:.|...:...:|::......:|...:||:.||..|:|...|:....:.:.:::.:|.
  Fly    72 VNKFFPRELEILTKIDHSNIIQIHSILQRGPKIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFF 136

  Fly   126 QLLSGLNYLHQRGIAHRDLKPENLLLDEHDNVKISDFGMATMFR-CKGKERLLDKRCGTLPYVAP 189
            |:...|.|||...|||||||.||:||.:..|:|::|||.|...| ..|:|...:..||:..|.||
  Fly   137 QMSKALKYLHNLDIAHRDLKCENILLSKRLNIKLADFGFARYCRDDNGREMKSETYCGSAAYAAP 201

  Fly   190 EVL-QKAYHAQPADLWSCGVILVTMLAGELPWDQPSTNCTEFTNWRDNDHW----QLQTPWSKLD 249
            ||: .:.|..:.||.||.||||..|:..::|:|  .:|.|:....:.|..:    :||...|...
  Fly   202 EVVCGRPYDPKLADAWSLGVILFIMMNAKMPFD--DSNLTKLLEDQRNRKFAFRRKLQETISAQA 264

  Fly   250 TLAISLLRKLLATSPGTRLTLEKTLDHKW 278
            ...:|:   ||......|..|.:.|:..|
  Fly   265 KATVSV---LLEPEAHARWNLREILNCAW 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grpNP_477011.1 STKc_Chk1 20..279 CDD:270971 83/271 (31%)
S_TKc 22..278 CDD:214567 81/266 (30%)
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 83/269 (31%)
S_TKc 28..287 CDD:214567 80/263 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.